PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016432341.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family B3
Protein Properties Length: 358aa    MW: 41523.8 Da    PI: 8.853
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016432341.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B348.51.5e-151694999
                    HHHHTT-EE--HHH.HTT..---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE-S CS
              B3  9 dvlksgrlvlpkkfaeeh..ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfrk 99
                      +k++ l +p  f+ ++  g+kk    +  +  ++g++W vk+  ++++    l++GW +F+++++L+ gD++vF+++g++ef   v++f++
  XP_016432341.1 16 PGFKHA-LKIPVGFL-KYlkGYKK----EHAILRKDGKKWLVKV--NGYQ----LEEGWGKFAEEHDLQLGDMLVFRHEGNMEF--EVTIFDS 94
                    455555.********.66555543....4567788*********..6665....*************************99999..9999986 PP

2B346.37.8e-151442191191
                     HHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE. CS
              B3  11 lksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefe 91 
                     lk g l++p +fa+e+g+ + ++  l+++de+ rsW+++l    + +r+++++ W eF  an+Lk+gD ++F+ + + +++
  XP_016432341.1 144 LK-GYLCIPTRFAAENGLTN-KNCGLIIRDERQRSWNLRL--YTSCSRVYIGGIWGEFRVANDLKVGDRIMFEIVTN-GEK 219
                     44.459**********7764.44579**************..889999*************************7764.444 PP

3B347.72.8e-15256336487
                     E-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SS CS
              B3   4 vltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgr 87 
                      ++++++ k++ l++p +fa+++g+++++  +++l+de  rsW+v l   +   ++ + +GW +F  an L++gD+  F+l+ +
  XP_016432341.1 256 STIKPYSIKKSVLYFPLDFAKSNGLINRK-CEMILKDEAQRSWSVWL--GRDAHHFGIIRGWTKFRAANCLQVGDVYKFELITN 336
                     56789999***************999766.5****************..9999999999*********************9864 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.104.5E-22497IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.33E-207101IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086312.689795IPR003340B3 DNA binding domain
CDDcd100177.78E-18893No hitNo description
SMARTSM010196.3E-161095IPR003340B3 DNA binding domain
PfamPF023621.4E-121894IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.103.9E-16132222IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.16E-15133224IPR015300DNA-binding pseudobarrel domain
SMARTSM010194.1E-7135228IPR003340B3 DNA binding domain
PfamPF023628.2E-13145222IPR003340B3 DNA binding domain
CDDcd100172.57E-12145212No hitNo description
PROSITE profilePS5086310.32150227IPR003340B3 DNA binding domain
SuperFamilySSF1019368.04E-19248346IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.105.7E-18249345IPR015300DNA-binding pseudobarrel domain
CDDcd100171.72E-15252345No hitNo description
PROSITE profilePS5086312.872253347IPR003340B3 DNA binding domain
SMARTSM010197.3E-17253347IPR003340B3 DNA binding domain
PfamPF023628.3E-14255336IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 358 aa     Download sequence    Send to blast
MKVRPVKPHF FKPIQPGFKH ALKIPVGFLK YLKGYKKEHA ILRKDGKKWL VKVNGYQLEE  60
GWGKFAEEHD LQLGDMLVFR HEGNMEFEVT IFDSSHCDRE YAEYMLDEEE ANNVEFKDKP  120
SAEADTHNPF GQSHFLCTVR PYCLKGYLCI PTRFAAENGL TNKNCGLIIR DERQRSWNLR  180
LYTSCSRVYI GGIWGEFRVA NDLKVGDRIM FEIVTNGEKP IWKFHDISIK PSDMIPLNAQ  240
VSTPTSGDND LPYFISTIKP YSIKKSVLYF PLDFAKSNGL INRKCEMILK DEAQRSWSVW  300
LGRDAHHFGI IRGWTKFRAA NCLQVGDVYK FELITNAKIP IAYFRCKYSA EVAKREDH
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016432341.10.0PREDICTED: B3 domain-containing protein REM10-like
TrEMBLM1AKH81e-129M1AKH8_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000941511e-123(Solanum tuberosum)
STRINGSolyc08g006240.1.11e-122(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA32215171
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24700.11e-56B3 family protein